PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P21620_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 281aa    MW: 32360.2 Da    PI: 5.1496
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P21620_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.2e-1879132356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k+++++ eq++ Le+ Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  GSMUA_Achr1P21620_001  79 KKRRLNMEQVRMLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWK 132
                            456899***********************************************9 PP

2HD-ZIP_I/II1314.6e-4278170193
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrl+ eqv++LE++Fe  +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+ Lkr+++a+++ene+L++++++L+
  GSMUA_Achr1P21620_001  78 EKKRRLNMEQVRMLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQFEAMRSENEALQSQNKKLQ 165
                            69************************************************************************************** PP

            HD-ZIP_I/II  89 eelke 93 
                            +e+++
  GSMUA_Achr1P21620_001 166 AEIMA 170
                            99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-1954135IPR009057Homeodomain-like
SuperFamilySSF466895.99E-2068136IPR009057Homeodomain-like
PROSITE profilePS5007117.274134IPR001356Homeobox domain
SMARTSM003898.9E-1877138IPR001356Homeobox domain
CDDcd000864.75E-1579135No hitNo description
PfamPF000461.3E-1579132IPR001356Homeobox domain
PRINTSPR000318.6E-6105114IPR000047Helix-turn-helix motif
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
PRINTSPR000318.6E-6114130IPR000047Helix-turn-helix motif
PfamPF021838.1E-15134174IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MASSSFFTPD YVLQMQTPHE EEEEERQLLR ATPCSNLQDL RAVGPMLGRR SMSFSGIENG  60
EGMNGEDELS DDGMQTGEKK RRLNMEQVRM LEKNFELGNK LEPERKMQLA RALGLQPRQV  120
AIWFQNRRAR WKTKQLEKDY DLLKRQFEAM RSENEALQSQ NKKLQAEIMA LKGRETSELI  180
NLNKETEASC SNRSENSSEI NLDISRTSVT ESPLHPHQSL PFFQSIRPAD IDQLLQSSSR  240
PDMQCPKIEN GVTEGSFSNL LCSMEDQSAS FWSWSDHHNF H
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126134RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009409197.10.0PREDICTED: homeobox-leucine zipper protein HOX21-like
SwissprotQ8S7W91e-102HOX21_ORYSJ; Homeobox-leucine zipper protein HOX21
TrEMBLM0S1X00.0M0S1X0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P21620_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-87HD-ZIP family protein